PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G001289_P01
Common NameLOC100279217
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family HD-ZIP
Protein Properties Length: 830aa    MW: 89654.2 Da    PI: 5.8698
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G001289_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.65.2e-19110166157
                        TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
           Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                        +++ +++t +q++e+e++F+++++p+ ++r+eL+++lgL   qVk+WFqN+R+++k+
  GRMZM2G001289_P01 110 KKRYHRHTLHQIQEMEAFFKECPHPDDKQRKELSRELGLVPLQVKFWFQNKRTQMKN 166
                        688899************************************************995 PP

2START191.54.1e-603055281206
                        HHHHHHHHHHHHHHHHC-TT-EEEE.......EXCCTTEEEEEEESSS.........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S CS
              START   1 elaeeaaqelvkkalaeepgWvkss.......esengdevlqkfeeskv........dsgealrasgvvdmvlallveellddkeqWdetla 77 
                        ela +a++elv++a+++ep+W   +       e +n++e+ + f+++++        +++ea+r+s vv+m++a lve+l+d++ q+ + + 
  GRMZM2G001289_P01 305 ELAVTAMEELVRMAQLDEPLWNAPAgghdgsaETLNEEEYARMFVPAGGlglkkqygFKSEASRDSSVVIMTHASLVEILMDVN-QYATVFS 395
                        57899******************99*********************999***********************************.8888888 PP

                        ....EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEEC CS
              START  78 ....kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepks 158
                            +a+tlev+s+g      galq+m+ e+q++splvp Rd++fvRy++q  +g+w++vdvS+d       +ssv +++++pSg+li++++
  GRMZM2G001289_P01 396 sivsRAATLEVLSTGvagnynGALQVMSVEFQVPSPLVPtRDSYFVRYCKQNADGTWAVVDVSLD-------TSSVLKCRRRPSGCLIQEMP 480
                        8888***********************************************************98.......568899************** PP

                        TCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
              START 159 nghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                        ng+skvtwvehv++++r++  +++ lv sgla+ga++wv tl+rqce+
  GRMZM2G001289_P01 481 NGYSKVTWVEHVEVDDRSVNGIYKLLVDSGLAFGARRWVGTLDRQCER 528
                        **********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.42E-1896167IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.9E-2196151IPR009057Homeodomain-like
PROSITE profilePS5007116.439107167IPR001356Homeobox domain
SMARTSM003893.4E-19108171IPR001356Homeobox domain
CDDcd000862.93E-18110168No hitNo description
PfamPF000461.3E-16110165IPR001356Homeobox domain
PROSITE patternPS000270142165IPR017970Homeobox, conserved site
Gene3DG3DSA:1.10.10.609.4E-4152194IPR009057Homeodomain-like
PROSITE profilePS5084839.256296531IPR002913START domain
SuperFamilySSF559616.92E-35297530No hitNo description
CDDcd088751.05E-114300527No hitNo description
SMARTSM002343.8E-52305528IPR002913START domain
PfamPF018526.2E-50306528IPR002913START domain
Gene3DG3DSA:3.30.530.208.6E-7371521IPR023393START-like domain
SuperFamilySSF559611.65E-18549638No hitNo description
SuperFamilySSF559611.65E-18679819No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007022developmental stageseed imbibition stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 830 aa     Download sequence    Send to blast
MMIPARHMPP TMIVRNGGAA YGSSSALSLG QPNLMDNQQL QFQQALQQQH LLLDQIPATT  60
AESCDNTGRG GGGRGSDPLA DEFESKSGSE NVDGVSVDDQ DDPNQRPSKK KRYHRHTLHQ  120
IQEMEAFFKE CPHPDDKQRK ELSRELGLVP LQVKFWFQNK RTQMKNQHER QENSQLRAEN  180
EKLRAENMRY KEALSSASCP NCGGPAALGE MSFDEHHLRV ENARLREEID RISAIAAKYV  240
GKPMVSFPVL SSPLAGARPS PLDIDSGGVL GGAATYGGAA DIFGGGGGVA ACGAARDCDK  300
PMIVELAVTA MEELVRMAQL DEPLWNAPAG GHDGSAETLN EEEYARMFVP AGGLGLKKQY  360
GFKSEASRDS SVVIMTHASL VEILMDVNQY ATVFSSIVSR AATLEVLSTG VAGNYNGALQ  420
VMSVEFQVPS PLVPTRDSYF VRYCKQNADG TWAVVDVSLD TSSVLKCRRR PSGCLIQEMP  480
NGYSKVTWVE HVEVDDRSVN GIYKLLVDSG LAFGARRWVG TLDRQCERLA SVMASNIPTS  540
DIGVITSTEG RKSMLKLAER MVTSFCGGVT ASAAHQWTTL SGSGADDVRV MTRKSVDDPG  600
RPPGIVLNAA TSFWLPITPK RVFDFLRDES SRSEARTRAP THTQFFFNRE HVLPSYEPPF  660
LFFFFLFLQW DILSNGGVVQ EMAHIANGRD HGNCVSLLRV NQSTNSTQSN MLILQESCTD  720
ASGSYVIYAP VDVVAMNVVL NGGDPDYVAL LPSGFAILPD GPSGSSNMQG GGGGGVGSGG  780
SLLTVAFQIL VDSVPTAKLS LGSVATVNSL IARTVERIKA AVSGESVTQQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.45140.0ear| meristem| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G001289
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G001289_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0538320.0BT053832.1 Zea mays full-length cDNA clone ZM_BFb0217B02 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008667763.10.0PREDICTED: uncharacterized protein LOC100279217 isoform X1
SwissprotQ0J9X20.0ROC2_ORYSJ; Homeobox-leucine zipper protein ROC2
TrEMBLA0A096PQ780.0A0A096PQ78_MAIZE; Uncharacterized protein
STRINGGRMZM2G001289_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79938147
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2